PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009766437.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 910aa    MW: 101222 Da    PI: 6.9154
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009766437.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.85.2e-29591641252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+isl++l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  XP_009766437.1 591 EKSISLQVLRQYFAGSLKDAAKNIGVCPTTLKRICRQHGITRWPSRKIKKV 641
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.450.407.4E-4184267IPR029016GAF domain-like
PROSITE profilePS5151917.393580661IPR003035RWP-RK domain
PfamPF020421.9E-24594641IPR003035RWP-RK domain
SuperFamilySSF542775.67E-23803898No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-20812892No hitNo description
PROSITE profilePS5174521.272813895IPR000270PB1 domain
PfamPF005644.8E-18813894IPR000270PB1 domain
SMARTSM006669.6E-24813895IPR000270PB1 domain
CDDcd064072.65E-37814894No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 910 aa     Download sequence    Send to blast
MEDGPFTLHD MFAKLSSDNT ISTSDFSEFL SDGFWLETTN HASNFLIPSS LASQPLLLDT  60
TNAGHSLPTA NQEETDKDKI LFAQMDDFSP TRRENSETSP RRLWIGPNIN PNPTLSVKKR  120
LVQAIEHLKD STRDKDVLIQ IWVPVKRGDK HVLITNNQPY FLNPNFQSLV EYRYVSQNYQ  180
FAAEKDSNEL VGLPGRVFLK KLPEWTPDVR FFKREEYPRV NHAHQYNVRG SIAVPVFETG  240
SGTCLGVVEI VTTTQKTHYH PELEDVCKAL EAVNLRSSGI SNPAKIKDCN ESYLAALAEI  300
QYILTCVCDT HKLPLAQTWA PCIQQGKGGC LQSDENSASC VTTVDEACYV RDPQVLPFHY  360
ACSEHHLLKG EGVAGGAFNT NQPCFATDIT AFSKTEYPLS HHARMFGLCS AVAIRLRSIY  420
TGSADFVLEF FLPLDCKNTE DQKQMLSSLS SVIQQSCRSL RVVTDQELLE EKELLQREKV  480
SLSAGESHEE VSRKPVSPPY RDEDASSWLS QMTDVQRKGK GAAISQEENF KVTANRWRES  540
IHASTYSEPN QIQDNFGPKG GYGGSLDFSS GTGSHSSGAK RAGERKRSKT EKSISLQVLR  600
QYFAGSLKDA AKNIGVCPTT LKRICRQHGI TRWPSRKIKK VGHSLQKLQL VIDSVHGAEG  660
AIKLSSFYTN FPELTSPNNP GTSNLSASKN HDHLQQVNTQ PDGSTLSPDT TTSKSTSSSG  720
SHNSSSSLFC STGSKHLFPL TNVFSTENAT MEEHPGGMLK RAHTEAELHD GGQEETKLLV  780
RSQSQKIQSN HNSLEPLCPL PTSSNQVIRD SATFKVKATF GKEKIRFSLQ SHWGFIDVLQ  840
EVLRRFNIED GKIDLKYLDD DDEWVLLTCD ADLEECVDIH RLCKRKTIKV SLHHAYHPNL  900
GSSFGSSGPA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1880889RLCKRKTIKV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2401980.0AC240198.1 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone hba-219g5 map 1, complete sequence.
GenBankAC2465860.0AC246586.3 Solanum lycopersicum strain Heinz 1706 chromosome 1 clone slm-20o20 map 1, complete sequence.
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
GenBankHG9755130.0HG975513.1 Solanum lycopersicum chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766436.10.0PREDICTED: protein NLP2-like
RefseqXP_009766437.10.0PREDICTED: protein NLP2-like
RefseqXP_009766438.10.0PREDICTED: protein NLP2-like
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLA0A0V0IVX10.0A0A0V0IVX1_SOLCH; Uncharacterized protein
STRINGSolyc01g112190.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein